PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009142199.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 640aa    MW: 70631.8 Da    PI: 6.5095
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009142199.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK88.45.8e-28338388252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     e ++sl +l+++Fs+++kdAA+++gvc+T+LKriCRq+GI+RWP+Rki+++
  XP_009142199.1 338 ERNVSLRVLQQHFSGSLKDAARSIGVCPTTLKRICRQHGIMRWPSRKINKV 388
                     6799*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.381325408IPR003035RWP-RK domain
PfamPF020424.4E-26340388IPR003035RWP-RK domain
SuperFamilySSF542776.87E-22528623No hitNo description
Gene3DG3DSA:3.10.20.2401.4E-22537618No hitNo description
SMARTSM006665.5E-22539621IPR000270PB1 domain
PROSITE profilePS5174519.962539621IPR000270PB1 domain
CDDcd064077.85E-33540620No hitNo description
PfamPF005642.4E-17540620IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 640 aa     Download sequence    Send to blast
MLSTCGQAYL LDPRLSQYRE VSRKFTFASK PNQSSYPGLP GRVFISGVRE WTPNVMYYKK  60
DEYLRVKHAI DNEVRGSIAI PILEASGASC CAVMELVTSD EKLSFDVELD SVCRALQAVD  120
LRTSVVPRPQ YLSSNQRDAL AEIQDVLRAL CHAHKLPLAL TWIPNSGVLC IEETACYVND  180
MDMEGFVHAC LDHPLREKEG IVGKAFVSNQ PSFSSDVKAY DISEYPLVHH ARKHGLNAAV  240
ALKLRSTYTG EDDYILELFL PLSLKGSLEQ QLLLDSLEGT LQRVCRTLRT VSDVEATSST  300
PSIFSDKSSD KDSTGSQGTC EQDMSKARTA ERTKGATERN VSLRVLQQHF SGSLKDAARS  360
IGVCPTTLKR ICRQHGIMRW PSRKINKVNR SLRKIQTVLD SVHGIEGGLR FDSATGEFVA  420
VCSSNGNNAH VMAEDASCEF LKPESVDNTI KLEDDIITNG SFMEVNASDQ PCALKAEQSG  480
FNGSSQEIAS GNIIEPNRSM SDSSHGSGAV MLRSSSPSMD DRNQRRAHKS NSSESGSATL  540
TVKATYREDT TRFKFDPSVG CLQLYKEVGK RFRLQEGLFQ LKYFDDEEEW VMLVTDSDLQ  600
ECLEMLVGMK KQTVKFLVRD LPAARIGSSA GSNGYLGAGL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009142199.10.0PREDICTED: protein NLP8-like isoform X2
SwissprotO228640.0NLP8_ARATH; Protein NLP8
TrEMBLM4F9E80.0M4F9E8_BRARP; Uncharacterized protein
STRINGBra037711.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G43500.20.0Nin-like family protein